PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G05100.1
Common NameAtMYB74, MYB74
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 324aa    MW: 37396.6 Da    PI: 6.9184
Description myb domain protein 74
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G05100.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W+t ++  g+ R++k+c++rw +yl
      AT4G05100.1 15 KGPWTPEEDQKLIDYINIHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.36.3e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
      AT4G05100.1  68 RGRFSFEEEETIIQLHSIMGNK-WSAIAARLP-GRTDNEIKNYWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-25765IPR009057Homeodomain-like
PROSITE profilePS5129418.4211062IPR017930Myb domain
SuperFamilySSF466891.16E-3112109IPR009057Homeodomain-like
SMARTSM007171.3E-131464IPR001005SANT/Myb domain
PfamPF002492.3E-161562IPR001005SANT/Myb domain
CDDcd001672.46E-121762No hitNo description
PROSITE profilePS5129425.02363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2766117IPR009057Homeodomain-like
SMARTSM007171.3E-1667115IPR001005SANT/Myb domain
PfamPF002492.3E-1568112IPR001005SANT/Myb domain
CDDcd001675.24E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRSPCCEKK NGLKKGPWTP EEDQKLIDYI NIHGYGNWRT LPKNAGLQRC GKSCRLRWTN  60
YLRPDIKRGR FSFEEEETII QLHSIMGNKW SAIAARLPGR TDNEIKNYWN THIRKRLLKM  120
GIDPVTHTPR LDLLDISSIL SSSIYNSSHH HHHHHQQHMN MSRLMMSDGN HQPLVNPEIL  180
KLATSLFSNQ NHPNNTHENN TVNQTEVNQY QTGYNMPGNE ELQSWFPIMD QFTNFQDLMP  240
MKTTVQNSLS YDDDCSKSNF VLEPYYSDFA SVLTTPSSSP TPLNSSSSTY INSSTCSTED  300
EKESYYSDNI TNYSFDVNGF LQFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109200.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306799800.0
Genevisible255250_at0.0
Expression AtlasAT4G05100-
AtGenExpressAT4G05100-
ATTED-IIAT4G05100-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00429DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G05100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT4G28110 (R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, jasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G10585
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G05100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869320.0AF386932.1 Arabidopsis thaliana Unknown protein mRNA, complete cds.
GenBankBT0011820.0BT001182.1 Arabidopsis thaliana Unknown protein (At4g05100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192419.10.0myb domain protein 74
SwissprotQ8GWP01e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9M0Y50.0Q9M0Y5_ARATH; MYB-like protein
STRINGAT4G05100.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  7. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  8. Krishnaswamy SS, et al.
    Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana.
    BMC Plant Biol., 2008. 8: p. 91
    [PMID:18783601]
  9. Lippold F, et al.
    AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1761-72
    [PMID:19211694]
  10. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  11. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  13. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]